If you have been reading about carcinogenicity and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
PPARδ is a nuclear receptor that regulates gene expression related to fatty acid oxidation, glucose homeostasis, and mitochondrial function. GW501516 binds to this receptor with high affinity and activates downstream signaling in skeletal muscle and other tissues. Animal studies reported increased endurance and altered fuel preference, but human data remain limited and inconsistent. The precise relationship between receptor activation and observed physiological changes is still an area of active investigation. Researchers have also examined whether the compound affects inflammation or cell proliferation. No approved therapeutic indication exists for cardarine.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
| Property | Value | Notes |
|---|---|---|
| WADA classification | S4 Hormone and Metabolic Modulators | Prohibited at all times in sport. |
| Drug approval status | Not approved in major jurisdictions | No accepted therapeutic indication. |
| Common detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Typical test matrix | Urine or blood | Urine is common in anti-doping testing. |
| Product labeling | Research chemical or supplement | Often not independently verified. |
GW501516 acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in transcription of genes related to lipid handling and energy use. Activation of PPARδ can shift skeletal muscle toward greater fatty acid oxidation in animal models, which is one reason it drew interest for metabolic disease and exercise research. The exact downstream effects depend on tissue, species, dose, and duration. Human data are sparse, so many proposed benefits remain hypotheses rather than established clinical outcomes.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
GW501516 acts on PPARδ, a nuclear receptor that helps regulate fatty acid oxidation and energy homeostasis. In animal studies, activation of this receptor was associated with increased endurance and changes in lipid metabolism. Human trials examined effects on blood lipids and other metabolic markers, but the compound did not advance to approval. Rodent studies later reported tumors in multiple tissues at doses used in those experiments. Whether those findings translate to human risk remains uncertain, and the clinical relevance of the animal data is still debated.
Regulatory bodies treat GW501516 as a prohibited substance in competitive sport. The World Anti-Doping Agency added it to the prohibited list, and it falls under classes covering metabolic modulators and hormone-related agents. It is not approved by drug regulators for human use, and it is not a lawful dietary supplement. Products sold under the cardarine name may contain unlisted ingredients or different compounds. Because no approved product exists, quality and identity are not guaranteed by pharmaceutical manufacturing standards.
Cardarine is a common name for the investigational chemical GW501516, also written GW-1516. It was developed as a peroxisome proliferator-activated receptor delta agonist for metabolic conditions such as dyslipidemia. Early research focused on lipid handling and energy use in skeletal muscle and other tissues. The compound was never approved as a medicine. In public discussion, it is often grouped with performance-enhancing substances, although its receptor target differs from that of anabolic steroids or selective androgen receptor modulators. Regulatory and health authorities have issued warnings about its use.
Laboratory studies indicate that GW501516 activates PPARδ, a nuclear receptor involved in fatty acid oxidation and energy metabolism. In rodent experiments, treated animals often showed increased endurance and reduced fat mass. These effects were observed under controlled conditions and do not establish safe or effective use in humans. The exact dose-response relationship in humans remains poorly characterized. Species differences in metabolism can affect how results translate across animals and people.
Safety concerns emerged from long-term animal studies. In rodents given the compound for extended periods, researchers found an increased incidence of certain cancers, including liver and bladder tumors. These findings contributed to the discontinuation of clinical development. Whether similar risks apply to short-term or low-level exposure in humans is not established, and controlled human safety data are limited. The relevance of high-dose rodent carcinogenicity findings to human use remains a subject of debate.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
Published human data are sparse and mostly come from early-phase trials. Those studies examined short-term changes in lipids, glucose, and exercise capacity, but they were not large enough to establish efficacy or long-term safety. Some animal experiments reported increased running endurance, yet such findings do not prove a performance benefit in people. Anti-doping laboratories detect GW501516 and its metabolites in urine or blood using liquid chromatography-tandem mass spectrometry. Detection windows depend on dose, sample type, and individual metabolism. The method is sensitive enough to identify trace residues in tested samples.
Laboratory handling focuses on identity, purity, and stability. Reference standards are typically stored cold and dry, protected from light, because solutions can degrade over time. Analytical checks may use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Impurities and related substances can be separated chromatographically and compared with a known standard. Because cardarine is not an approved drug, compendial monographs are absent, and laboratories often rely on in-house methods. Reported purity varies among unregulated products and should not be assumed from a label.
GW501516 binds and activates PPARδ, a nuclear receptor that influences transcription of genes involved in fatty acid oxidation and energy use. Activation shifts some metabolic pathways in preclinical models, which is why the compound has been studied for lipid disorders and exercise-related endpoints. The exact downstream effects in humans are incompletely mapped. PPARδ is expressed in many tissues, including skeletal muscle, liver, and adipose tissue, so broad activation may have varied consequences. Researchers continue to examine how selective or partial activation might alter the balance between benefits and risks.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Herbivorous dinosaurs exhibited convergent evolution towards one of two feeding strategies, one strategy resembling mammalian herbivores (emphasizing chewing-specialized morphology, with the skull acquiring and processing food) and another strategy analogous to herbivory in birds and reptiles (emphasizing a specialized gut as in the avian gizzard, with the skull used only for acquiring rather than processing food).
Foster (1895–1970), Manhattan Project chemist and the first female chemist to work for the United States Geological Survey Antoine François, comte de Fourcroy (1775–1809), co-discovered the element Iridium and developed modern chemical notation Joanna Fowler (born 1942), American neural chemist who studied effects on the human brain and radiotracers in brain chemistry Michelle Francl (PhD 1983), American computational chemist known for the 6-31G* basis set for Na to Ar and electrostatic potential charges Edward Frankland (1825–1899), English chemist, one of the originators of organometallic chemistry who introduced the concept of valence Rosalind Franklin (1920–1958), British chemist and crystallographer whose work was central to understanding the molecular structure of DNA Katherine Franz (born 1972), American chemist noted for work in metal ion coordination in biological systems Herman Frasch (1851–1914), German mining engineer and inventor, pioneered the Frasch process Bertram Fraser-Reid (1934–2020), Jamaican synthetic organic chemist who developed the armed-disarmed principle in glycosylation chemistry Helen Murray Free (1923–2021), American chemist who developed self-testing systems for diabetes Carl Remigius Fresenius (1818–1897), German chemist known for work in analytical chemistry Ida Freund (1863–1914), British chemist known for texts on chemistry teaching, andy first woman university chemistry lecturer in the UK Charles Friedel (1832–1899), French chemist, developer of Friedel–Crafts reaction Alexander Naumovich Frumkin (1895–1976), electrochemist and chemist who develped applied electrochemical processes related to chemical sources of electrical power Kenichi Fukui (1918–1998), 1981 Nobel Prize in Chemistry for investigating mechanisms of chemical reactions Elizabeth Fulhame (18th–19th centuries), British chemist, pioneer in the study of catalysis and discoverer of photoreduction Vera Furness (1921–2002), English chemist and industrial manager who worked on the production of the acrylic Courtelle
A ligament is a type of fibrous connective tissue in the body that connects bones to other bones. It also connects flight feathers to bones, in dinosaurs and birds. All 30,000 species of amniotes (land animals with internal bones) have ligaments. It is also known as articular ligament, articular larua, fibrous ligament, or true ligament.
Sources: en.wikipedia.org
In 2015, Xi's administration oversaw the establishment of two circuit courts under the Supreme People's Court, followed by four other circuit courts being established in 2016. Hangzhou Internet Court was established as a court of special jurisdiction in 2017, followed by the establishment of Beijing Internet Court and Guangzhou Internet Court. Shanghai Financial Court was established in 2018 as a specialized financial court. Under Xi, an increasing share of laws passed by the NPC explicitly affirmed the leadership of the CCP, with the share increasing from 4% in 2018 to nearly 70% in 2024.
== Lifetime == According to Vladimir Uglev, who headed a group that worked on the development of the Novichok agents, at least one liquid form of Novichok is very stable with a slow evaporation rate and can remain potent for possibly up to 50 years. Insufficient research has been conducted to fully understand its persistence in various situations in the environment.
=== World Health Organization === The World Health Organization has declared that finding where SARS-CoV-2 came from is a priority and that it is "essential for understanding how the pandemic started." In May 2020, the World Health Assembly, which governs the World Health Organization (WHO), passed a motion calling for a "comprehensive, independent and impartial" study into the COVID-19 pandemic. A record 137 countries, including China, co-sponsored the motion, giving overwhelming international endorsement to the study. In mid 2020, the World Health Organization (WHO) began negotiations with the government of China on conducting an official study into the origins of COVID-19. In November 2020, the WHO published a two-phase study plan. The purpose of the first phase was to better understand how the virus "might have started circulating in Wuhan", and a second phase involves longer-term studies based on the findings of the first phase. WHO director-general Tedros Adhanom said "We need to know the origin of this virus because it can help us to prevent future outbreaks," adding, "There is nothing to hide. We want to know the origin, and that's it." He also urged countries not to politicise the origin tracing process, saying that would only create barriers to learning the truth. In 2021, the World Health Assembly (on behalf of the WHO) commissioned a study conducted jointly between WHO experts and Chinese scientists. Echoing the assessment of most virologists, the study concluded that the virus most likely had a zoonotic origin in bats, possibly via an intermediate host.
Sources: en.wikipedia.org
François Vandenesch; Timothy S Naimi; Mark Enright; et al. (2003). "Community-acquired methicillin-resistant Staphylococcus aureus carrying Panton-Valentine leukocidin genes: worldwide emergence". Emerging Infectious Diseases. 9 (8): 978–984. doi:10.3201/eid0908.030089. PMC 3020611. PMID 12967497. Wikidata Q24598936. Cameron Burton; Emma Best; Matthew Broom; Helen Heffernan; Simon Briggs; Rachel Webb (2023). "Pediatric Invasive Meningococcal Disease, Auckland, New Zealand (Aotearoa), 2004–2020". Emerging Infectious Diseases. 29 (4): 686–695. doi:10.3201/eid2904.221397. PMID 36957984. Wikidata Q130355931. Deborah A Williamson; Hanna E. Sidjabat; Joshua T Freeman; et al. (2012). "Identification and molecular characterisation of New Delhi metallo-β-lactamase-1 (NDM-1)- and NDM-6-producing Enterobacteriaceae from New Zealand hospitals". International Journal of Antimicrobial Agents. 39 (6): 529–533. doi:10.1016/j.ijantimicag.2012.02.017. PMID 22526013. Wikidata Q48050341. Joshua T Freeman; Stephen J McBride; Helen Heffernan; Tracy Bathgate; Chris Pope; Roderick B Ellis-Pegler (2008). "Community-onset genitourinary tract infection due to CTX-M-15-Producing Escherichia coli among travelers to the Indian subcontinent in New Zealand". Clinical Infectious Diseases. 47 (5): 689–692. doi:10.1086/590941. PMID 18665816. Wikidata Q45138244. Rajan P Adhikari; Gregory M Cook; Iain Lamont; Selwyn Lang; Helen Heffernan; John M B Smith (2002). "Phenotypic and molecular characterization of community occurring, Western Samoan phage pattern methicillin-resistant Staphylococcus aureus".
== Consideration for retailers == As with the public health concerns, the following concerns have been posed but data are not yet available to prove or disprove them. Because of the unique characteristics of powdered alcohol, introduction in the U.S. could raise significant concerns from alcohol retailers as it will raise the awareness of their customers health and well as a major priority. including such as restaurants, bars, and sporting venues, including:
After hypoglycemia in a person is identified, rapid treatment is necessary and can be life-saving. The main goal of treatment is to raise blood glucose back to normal levels, which is done through various ways of administering glucose, depending on the severity of the hypoglycemia, what is on-hand to treat, and who is administering the treatment. A general rule used by the American Diabetes Association is the "15-15 Rule," which suggests consuming or administering 15 grams of a carbohydrate, followed by a 15-minute wait and re-measurement of blood glucose level to assess if blood glucose has returned to normal levels.
==== Adult ==== Testosterone is necessary for normal sperm development. It activates genes in Sertoli cells, which promote differentiation of spermatogonia. It regulates acute hypothalamic–pituitary–adrenal axis (HPA axis) response under dominance challenge. Androgens including testosterone enhance muscle growth. Testosterone also regulates the population of thromboxane A2 receptors on megakaryocytes and platelets and hence platelet aggregation in humans. Adult testosterone effects are more clearly demonstrable in males than in females, but are likely important to both sexes. Some of these effects may decline as testosterone levels might decrease in the later decades of adult life. The brain is also affected by this sexual differentiation; the enzyme aromatase converts testosterone into estradiol that is responsible for masculinization of the brain in male mice. In humans, masculinization of the fetal brain appears, by observation of gender preference in patients with congenital disorders of androgen formation or androgen receptor function, to be associated with functional androgen receptors. There are some differences between a male and female brain that may be due to different testosterone levels, one of them being size: the male human brain is, on average, larger.
Sources: en.wikipedia.org
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.
Legality varies by country and context. It lacks marketing approval as a medicine in major countries. Sports organizations prohibit its use at all times.
A certificate of analysis may report identity, purity, and testing methods for a specific batch. It does not guarantee safety or legal status. Independent verification can confirm whether the material matches the label.
Cardarine is a common name for GW501516, a synthetic PPARδ agonist developed for research. It has not been approved as a medication in any country. It is classified as an unapproved drug and a prohibited substance in sport.