PPAR delta comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-02-25. Where a claim depends on a specific study, the study is described rather than over-claimed.
Preclinical research reported that GW501516 increased running endurance in mice and improved lipid profiles in some animal species. Early human trials explored effects on high-density lipoprotein cholesterol, triglycerides, and glucose handling, but the program was discontinued. Published human data are sparse and do not establish efficacy for any condition. Studies also examined PPAR delta in cancer biology, with conflicting findings across models. The relationship between receptor activation, tissue context, and disease risk remains an active area of investigation.
Anti-doping laboratories identify GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the usual matrix, and detection can occur after the parent compound has cleared from blood. The exact detection window depends on dose, formulation, individual metabolism, and assay sensitivity. Because the compound is prohibited at all times, athletes are subject to testing in and out of competition. Analytical methods continue to improve as new metabolites and designer analogs are characterized.
Products sold as cardarine have been found to contain incorrect compounds, variable amounts, or no active ingredient at all. Independent testing is required to verify identity and purity. Common analytical approaches include high-performance liquid chromatography, mass spectrometry, and nuclear magnetic resonance for structural confirmation. These methods can distinguish GW501516 from related PPAR agonists and from unrelated steroids. For regulators and researchers, such verification is central to interpreting both biological results and adverse event reports.
Cardarine is prohibited in competitive sport under the World Anti-Doping Agency code, where it is classified as a metabolic modulator. It is not approved as a prescription medicine in the United States, European Union, or other major markets. Regulatory action has focused on its presence in sports and in products marketed as research chemicals. Because it has no accepted medical indication, supply is often unregulated. This status creates legal and safety uncertainties for anyone who encounters the substance.
Anti-doping laboratories detect GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be used in some programs. Detection depends on factors such as dose, timing, metabolism, and the sensitivity of the assay. Published methods describe limits of detection in the low nanogram per milliliter range for related compounds. Exact detection windows are not fixed for all situations and remain an area of ongoing study.
| Property | Value | Notes |
|---|---|---|
| Molecular target | PPAR delta (NR1C2) | Ligand-activated nuclear receptor. |
| Primary tissues studied | Skeletal muscle, liver, adipose | Effects on fatty acid oxidation and energy use. |
| Typical detection matrix | Urine | Used in anti-doping analysis. |
| Common analytical method | LC-MS/MS | Detects parent compound and metabolites. |
| Sport regulatory class | Prohibited at all times | Listed as a metabolic modulator by WADA. |
corrects this dilution effect by multiplying the fraction of the susceptible population over the total population. It corrects the effective/transmissible interaction between an infectious person and the rest of the community when many of the interaction is immune in the middle to late stages of the disease spreading. Thus, when
The Royal Italian Army ate mainly pasta, white bread, oatmeal, meat, fish, broth, salad, sugar, cheese, and butter from their field kitchens, with alcohol and desserts also issued. However, on the front, Italian soldiers often had to live off of canned tuna, ham, soup, black bread, and pasta. The canned food issued to soldiers on deployment was of low quality, and Italian soldiers had to drink water out of and cook pasta in unwashed gasoline drums, leading to gasoline-flavored water and pasta. Regular supplies of food were strained by logistical issues during the North African campaign.
== External links == Handy calculator for density, enthalpy, entropy and other thermodynamic data of supercritical CO2 / water and others videos to present supercritical fluid critical point and solubility in supercritical fluid NewScientist Environment FOUND:The hottest water on Earth Poliakoff, Martyn (28 April 2008). "Supercritical fluids". Test Tube. Brady Haran for the University of Nottingham.
Filament notching is due to uneven evaporation of the filament. Small variations in resistivity along the filament cause "hot spots" to form at points of higher resistivity; a variation of diameter of only 1% will cause a 25% reduction in service life. Since filament resistance is highly temperature-dependent, spots with higher temperature will have higher resistance, causing them to dissipate more energy, making them hotter – a positive feedback loop. These hot spots evaporate faster than the rest of the filament, permanently increasing the resistance at that point. The process ends in the familiar tiny gap in an otherwise healthy-looking filament. Lamps operated on direct current develop random stairstep irregularities on the filament surface which may cut lifespan in half compared to AC operation; different alloys of tungsten and rhenium can be used to counteract the effect. Since a filament breaking in a gas-filled bulb can form an electric arc, which may spread between the terminals and draw very heavy current, intentionally thin lead-in wires or more elaborate protection devices are therefore often used as fuses built into the light bulb. More nitrogen is used in higher-voltage lamps to reduce the possibility of arcing.
While most organisms utilize the ubiquitous NAD+-dependent 2-oxoglutarate dehydrogenase, some bacteria utilize a ferredoxin-dependent 2-oxoglutarate synthase (EC 1.2.7.3). Other organisms, including obligately autotrophic and methanotrophic bacteria and archaea, bypass succinyl-CoA entirely, and convert 2-oxoglutarate to succinate via succinate semialdehyde, using EC 4.1.1.71, 2-oxoglutarate decarboxylase, and EC 1.2.1.79, succinate-semialdehyde dehydrogenase.
Sources: en.wikipedia.org
According to the BPC: "...the plan would enact tax reform by lowering both the corporate and individual income tax rates and raising revenue by broadening the base. Policies are endorsed that improve the health of the Social Security program, restrain health care cost growth, control annually appropriated spending, and make cuts to other entitlement programs." The plan proposes to raise approximately $1 trillion less revenue over the 2013–2022 decade than the Simpson-Bowles and Domenici-Rivlin plans, while cutting non-defense discretionary spending more deeply and reducing the defense spending cuts mandated in the Budget Control Act of 2011. According to the Center on Budget and Policy Priorities, this plan is ideologically to the Right of either the Simpson-Bowles or Domenici-Rivlin plans. In May 2012, House Republicans put forward five separate budget proposals for a vote in the Senate. The Republican proposals included the House-approved proposal by House Budget Chairman Paul Ryan and one that was very close in content to the budget proposal submitted earlier in 2012 by President Barack Obama. The other three proposals each called for greatly reduced government spending. The budget put forward by Senator Mike Lee would halve the government over the next 25 years. Senator Rand Paul's budget included proposed cuts to Medicare, Social Security benefits and the closure of four Cabinet departments. The budget plan from Senator Patrick Toomey aimed to balance the budget within eight years. All five of the proposed plans were rejected in the Senate.
Between each step, the plate is typically washed with a mild detergent solution to remove any proteins or antibodies that are non-specifically bound. After the final wash step, the plate is developed by adding an enzymatic substrate to produce a visible signal, which indicates the quantity of antigen in the sample. Of note, ELISA can perform other forms of ligand binding assays instead of strictly "immuno" assays, though the name carried the original "immuno" because of the common use and history of the development of this method. The technique essentially requires any ligating reagent that can be immobilized on the solid phase along with a detection reagent that will bind specifically and use an enzyme to generate a signal that can be properly quantified. In between the washes, only the ligand and its specific binding counterparts remain specifically bound or "immunosorbed" by antigen-antibody interactions to the solid phase, while the nonspecific or unbound components are washed away. Unlike other spectrophotometric wet lab assay formats where the same reaction well (e.g., a cuvette) can be reused after washing, the ELISA plates have the reaction products immunosorbed on the solid phase, which is part of the plate and so are not easily reusable.
Before the election, U.S. officials and former officials stated that foreign interference in the 2024 election was likely. Three major factors cited were "America's deepening domestic political crises, the collapse of controversial attempts to control political speech on social media, and the rise of generative AI". China, Russia, and Iran were identified as mounting influence operations and attempts to interfere with the 2024 election. U.S. intelligence officials described the efforts as part of broader efforts by authoritarian nations to use the internet to erode support for democracy.
=== EC 1.10.3 With oxygen as acceptor === EC 1.10.3.1: catechol oxidase EC 1.10.3.2: laccase EC 1.10.3.3: L-ascorbate oxidase EC 1.10.3.4: o-aminophenol oxidase EC 1.10.3.5: 3-hydroxyanthranilate oxidase EC 1.10.3.6: rifamycin-B oxidase EC 1.10.3.7: Now EC 1.21.3.4, sulochrin oxidase [(+)-bisdechlorogeodin-forming] EC 1.10.3.8: Now EC 1.21.3.5, sulochrin oxidase [(-)-bisdechlorogeodin-forming] EC 1.10.3.9: photosystem II EC 1.10.3.10: Now EC 7.1.1.3, ubiquinol oxidase (H+-transporting) EC 1.10.3.11: ubiquinol oxidase (non-electrogenic) EC 1.10.3.12: Now EC 7.1.1.5, menaquinol oxidase (H+-transporting) EC 1.10.3.13: Now EC 7.1.1.4, caldariellaquinol oxidase (H+-transporting) EC 1.10.3.14: Now EC 7.1.1.7, ubiquinol oxidase (electrogenic, proton-motive force generating) EC 1.10.3.15: grixazone synthase EC 1.10.3.16: dihydrophenazinedicarboxylate synthase EC 1.10.3.17: superoxide oxidase
Sources: en.wikipedia.org
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
ketogenic amino acid Any amino acid that can be converted directly into acetyl-CoA, which can then be oxidized for energy or used as a precursor for many compounds containing ketone groups. This is in contrast to the glucogenic amino acids, which can be converted into glucose. In humans, seven of the 20 amino acids are ketogenic, though only leucine and lysine are exclusively ketogenic; the other five (phenylalanine, isoleucine, threonine, tryptophan, and tyrosine) are both ketogenic and glucogenic.
Xenobiology (XB) is a subfield of synthetic biology, the study of synthesizing and manipulating biological devices and systems. The name xenobiology derives from the Ancient Greek word ξένος (xénos), meaning "stranger", "foreigner", or "alien". Xenobiology is a form of biology that is not (yet) familiar to science and is not found in nature. In practice, it describes novel biological systems and biochemistries that differ from the canonical DNA–RNA-20 amino acid system (see central dogma of molecular biology). For example, instead of DNA or RNA, the field of xenobiology explores nucleic acid analogues, termed xeno nucleic acid (XNA) as information carriers. It also focuses on an expanded genetic code and the incorporation of non-proteinogenic amino acids, or "xeno amino acids" into proteins.
In 2013, Germany revealed the existence of their 60-person Computer Network Operation unit. The German intelligence agency, BND, announced it was seeking to hire 130 "hackers" for a new "cyber defence station" unit. In March 2013, BND president Gerhard Schindler announced that his agency had observed up to five attacks a day on government authorities, thought mainly to originate in China. He confirmed the attackers had so far only accessed data and expressed concern that the stolen information could be used as the basis of future sabotage attacks against arms manufacturers, telecommunications companies and government and military agencies. Shortly after Edward Snowden leaked details of the U.S. National Security Agency's cyber surveillance system, German Interior Minister Hans-Peter Friedrich announced that the BND would be given an additional budget of 100 million Euros to increase their cyber surveillance capability from 5% of total internet traffic in Germany to 20% of total traffic, the maximum amount allowed by German law.
=== Ga–Go === Elmer L. Gaden (1923–2012). American biochemical engineer at the University of Virginia, known as the father of biochemical engineering. Michael H. Gelb (b. 1957). American biochemist at the University of Washington who studies study enzymatic processes of biomedical significance. Susan Gerbi, (b. 1944). American biochemist at Brown University working on RNA and DNA. Jonathan Gershenzon (b. 1955). American biochemist at the Max Planck Institute for Chemical Ecology in Jena, known for work on the biochemistry of secondary plant metabolites. Quentin Gibson FRS (1918–2011). British-American biochemist at Sheffield and later Cornell University who worked on haem proteins. Member Natl. Acad. Sci. USA. Walter Gilbert FRS (foreign member) (b. 1932). American biochemist at Harvard, awarded the Nobel Prize in Chemistry (1980) for work on DNA sequencing. Member Natl. Acad. Sci. USA. H. Bentley Glass (1906–2005). American biochemist at the State University of New York at Stony Brook. Member Natl. Acad. Sci. USA Joseph L. Goldstein (b. 1940). American biochemist at the University of Texas, awarded the Nobel Prize in Physiology or Medicine (1985) for studies of cholesterol. Member Natl. Acad. Sci. USA. Eugene Goldwasser (1922–2010). American biochemist at the University of Chicago, known for identifying the hormone erythropoietin. Michael M. Gottesman (b. 1946). American biochemist at the NIH, whose achievements includes the discovery of P-glycoprotein. Member Natl. Acad. Sci. USA. Alfred Gottschalk (1894–1973).
Sources: en.wikipedia.org
It binds to and activates PPAR delta, a nuclear receptor that controls expression of genes related to fatty acid oxidation. This mechanism can alter energy metabolism in animal models. It is not a direct stimulant or fat-burning enzyme.
Early-stage trials examined lipid and glucose markers, but the development program was discontinued. Published human results are limited and do not support approved use for any indication. Claims of performance or health benefits remain unproven.
Yes. Laboratories use LC-MS/MS to detect GW501516 and its metabolites in urine. Detection depends on timing and sensitivity, but the substance is banned at all times.
Legal status varies by country, but cardarine is not approved as a medicine in major jurisdictions. It is often sold as a research chemical, a category that may not be lawful for human use. Buyers should check local laws and product labels carefully.